TMED8 antibody (70R-3834)

Rabbit polyclonal TMED8 antibody raised against the middle region of TMED8

Synonyms Polyclonal TMED8 antibody, Anti-TMED8 antibody, TMED-8 antibody, FAM15B antibody, TMED 8, TMED-8, Transmembrane Emp24 Protein Transport Domain Containing 8 antibody, TMED8, TMED 8 antibody, MGC126559 antibody
Specificity TMED8 antibody was raised against the middle region of TMED8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI
Assay Information TMED8 Blocking Peptide, catalog no. 33R-2466, is also available for use as a blocking control in assays to test for specificity of this TMED8 antibody

Images

Western Blot analysis using TMED8 antibody (70R-3834)

TMED8 antibody (70R-3834) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMED8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMED8 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMED8 antibody (70R-3834) | TMED8 antibody (70R-3834) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors