TMEM106C antibody (70R-6741)

Rabbit polyclonal TMEM106C antibody raised against the middle region of TMEM106C

Synonyms Polyclonal TMEM106C antibody, Anti-TMEM106C antibody, Transmembrane Protein 106C antibody, TMEM106C, MGC111210 antibody, TMEMC 106, MGC5576 antibody, TMEMC-106 antibody, TMEMC-106, TMEMC 106 antibody
Specificity TMEM106C antibody was raised against the middle region of TMEM106C
Cross Reactivity Human
Applications WB
Immunogen TMEM106C antibody was raised using the middle region of TMEM106C corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG
Assay Information TMEM106C Blocking Peptide, catalog no. 33R-6694, is also available for use as a blocking control in assays to test for specificity of this TMEM106C antibody

Images

Western Blot analysis using TMEM106C antibody (70R-6741)

TMEM106C antibody (70R-6741) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM106C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM106C belongs to the TMEM106 family. The exact function of TMEM106C remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM106C antibody (70R-6741) | TMEM106C antibody (70R-6741) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors