TMEM110 antibody (70R-7086)

Rabbit polyclonal TMEM110 antibody raised against the N terminal of TMEM110

Synonyms Polyclonal TMEM110 antibody, Anti-TMEM110 antibody, DKFZp667E1121 antibody, TMEM-110 antibody, Transmembrane Protein 110 antibody, TMEM 110 antibody, TMEM110, TMEM-110, MGC52022 antibody, TMEM 110
Specificity TMEM110 antibody was raised against the N terminal of TMEM110
Cross Reactivity Human
Applications WB
Immunogen TMEM110 antibody was raised using the N terminal of TMEM110 corresponding to a region with amino acids MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFS
Assay Information TMEM110 Blocking Peptide, catalog no. 33R-6328, is also available for use as a blocking control in assays to test for specificity of this TMEM110 antibody

Images

Western Blot analysis using TMEM110 antibody (70R-7086)

TMEM110 antibody (70R-7086) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM110 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM110 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM110 antibody (70R-7086) | TMEM110 antibody (70R-7086) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors