TMEM117 antibody (70R-7032)

Rabbit polyclonal TMEM117 antibody raised against the middle region of TMEM117

Synonyms Polyclonal TMEM117 antibody, Anti-TMEM117 antibody, TMEM 117 antibody, TMEM-117, TMEM117, Transmembrane Protein 117 antibody, TMEM-117 antibody, TMEM 117
Specificity TMEM117 antibody was raised against the middle region of TMEM117
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM117 antibody was raised using the middle region of TMEM117 corresponding to a region with amino acids GQYIGPGQKIYTVKDSESLKDLNRTKLSWEWRSNHTNPRTNKTYVEGDMF
Assay Information TMEM117 Blocking Peptide, catalog no. 33R-3520, is also available for use as a blocking control in assays to test for specificity of this TMEM117 antibody

Images

Western Blot analysis using TMEM117 antibody (70R-7032)

TMEM117 antibody (70R-7032) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM117 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM117 is a multi-pass membrane protein. It belongs to the TMEM117 family. The exact function of TMEM117 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM117 antibody (70R-7032) | TMEM117 antibody (70R-7032) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors