TMEM118 antibody (70R-6918)

Rabbit polyclonal TMEM118 antibody raised against the N terminal Of Tmem118

Synonyms Polyclonal TMEM118 antibody, Anti-TMEM118 antibody, Transmembrane Protein 118 antibody, TMEM 118, TMEM118, FLJ14627 antibody, TMEM 118 antibody, TMEM-118, TMEM-118 antibody
Specificity TMEM118 antibody was raised against the N terminal Of Tmem118
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TMEM118 antibody was raised using the N terminal Of Tmem118 corresponding to a region with amino acids HGGHRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGL
Assay Information TMEM118 Blocking Peptide, catalog no. 33R-3736, is also available for use as a blocking control in assays to test for specificity of this TMEM118 antibody

Images

Western Blot analysis using TMEM118 antibody (70R-6918)

TMEM118 antibody (70R-6918) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM118 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM118 is a multi-pass membrane protein, and contains 1 RING-type zinc finger. The function of TMEM118 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM118 antibody (70R-6918) | TMEM118 antibody (70R-6918) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors