TMEM123 antibody (70R-7328)

Rabbit polyclonal TMEM123 antibody raised against the C terminal of TMEM123

Synonyms Polyclonal TMEM123 antibody, Anti-TMEM123 antibody, TMEM-123 antibody, TMEM 123, TMEM123, Transmembrane Protein 123 antibody, TMEM-123, KCT3 antibody, PORIMIN antibody, TMEM 123 antibody, PORMIN antibody
Specificity TMEM123 antibody was raised against the C terminal of TMEM123
Cross Reactivity Human
Applications WB
Immunogen TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG
Assay Information TMEM123 Blocking Peptide, catalog no. 33R-8860, is also available for use as a blocking control in assays to test for specificity of this TMEM123 antibody

Images

Western Blot analysis using TMEM123 antibody (70R-7328)

TMEM123 antibody (70R-7328) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM123 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM123 is a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. TMEM123 is proposed to function as a cell surface receptor that mediates cell death.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM123 antibody (70R-7328) | TMEM123 antibody (70R-7328) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors