TMEM126B antibody (70R-1816)

Rabbit polyclonal TMEM126B antibody raised against the middle region of TMEM126B

Synonyms Polyclonal TMEM126B antibody, Anti-TMEM126B antibody, Transmembrane Protein 126B antibody, TMEMB 126 antibody, MGC111203 antibody, TMEMB-126 antibody, HT007 antibody, TMEMB-126, TMEMB 126, TMEM126B
Specificity TMEM126B antibody was raised against the middle region of TMEM126B
Cross Reactivity Human
Applications WB
Immunogen TMEM126B antibody was raised using the middle region of TMEM126B corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC
Assay Information TMEM126B Blocking Peptide, catalog no. 33R-9538, is also available for use as a blocking control in assays to test for specificity of this TMEM126B antibody

Images

Western Blot analysis using TMEM126B antibody (70R-1816)

TMEM126B antibody (70R-1816) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of TMEM126B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM126B protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM126B antibody (70R-1816) | TMEM126B antibody (70R-1816) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors