TMEM126B antibody (70R-6675)

Rabbit polyclonal TMEM126B antibody raised against the N terminal of TMEM126B

Synonyms Polyclonal TMEM126B antibody, Anti-TMEM126B antibody, TMEM126B, MGC111203 antibody, Transmembrane Protein 126B antibody, TMEMB-126 antibody, HT007 antibody, TMEMB-126, TMEMB 126 antibody, TMEMB 126
Specificity TMEM126B antibody was raised against the N terminal of TMEM126B
Cross Reactivity Human
Applications WB
Immunogen TMEM126B antibody was raised using the N terminal of TMEM126B corresponding to a region with amino acids AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT
Assay Information TMEM126B Blocking Peptide, catalog no. 33R-1047, is also available for use as a blocking control in assays to test for specificity of this TMEM126B antibody

Images

Western Blot analysis using TMEM126B antibody (70R-6675)

TMEM126B antibody (70R-6675) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM126B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM126B belongs to the TMEM126 family. The function remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM126B antibody (70R-6675) | TMEM126B antibody (70R-6675) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors