TMEM127 antibody (70R-6881)

Rabbit polyclonal TMEM127 antibody raised against the middle region of TMEM127

Synonyms Polyclonal TMEM127 antibody, Anti-TMEM127 antibody, FLJ22257 antibody, TMEM127, FLJ20507 antibody, Transmembrane Protein 127 antibody, TMEM 127 antibody, TMEM 127, TMEM-127 antibody, TMEM-127
Specificity TMEM127 antibody was raised against the middle region of TMEM127
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ
Assay Information TMEM127 Blocking Peptide, catalog no. 33R-1166, is also available for use as a blocking control in assays to test for specificity of this TMEM127 antibody

Images

Western Blot analysis using TMEM127 antibody (70R-6881)

TMEM127 antibody (70R-6881) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM127 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM127 is a multi-pass membrane protein. The exact function of TMEM127 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM127 antibody (70R-6881) | TMEM127 antibody (70R-6881) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors