TMEM132B antibody (70R-6922)

Rabbit polyclonal TMEM132B antibody raised against the middle region of TMEM132B

Synonyms Polyclonal TMEM132B antibody, Anti-TMEM132B antibody, TMEMB-132 antibody, TMEMB 132 antibody, TMEMB 132, TMEM132B, Transmembrane Protein 132B antibody, KIAA1786 antibody, KIAA1906 antibody, TMEMB-132
Specificity TMEM132B antibody was raised against the middle region of TMEM132B
Cross Reactivity Human
Applications WB
Immunogen TMEM132B antibody was raised using the middle region of TMEM132B corresponding to a region with amino acids VQEWFHRGTPVGQEESTNKSTTPQSPMEGKNKLLKSGGPDAFTSFPTQGK
Assay Information TMEM132B Blocking Peptide, catalog no. 33R-9746, is also available for use as a blocking control in assays to test for specificity of this TMEM132B antibody

Images

Western Blot analysis using TMEM132B antibody (70R-6922)

TMEM132B antibody (70R-6922) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 119 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM132B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM132B single-pass type I membrane protein. It belongs to the TMEM132 family. The exact function of TMEM132B is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM132B antibody (70R-6922) | TMEM132B antibody (70R-6922) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors