TMEM135 antibody (70R-6274)

Rabbit polyclonal TMEM135 antibody raised against the N terminal of TMEM135

Synonyms Polyclonal TMEM135 antibody, Anti-TMEM135 antibody, TMEM-135 antibody, TMEM 135 antibody, FLJ22104 antibody, TMEM 135, TMEM135, DKFZp686I1974 antibody, TMEM-135, Transmembrane Protein 135 antibody
Specificity TMEM135 antibody was raised against the N terminal of TMEM135
Cross Reactivity Human
Applications WB
Immunogen TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC
Assay Information TMEM135 Blocking Peptide, catalog no. 33R-8601, is also available for use as a blocking control in assays to test for specificity of this TMEM135 antibody

Images

Western Blot analysis using TMEM135 antibody (70R-6274)

TMEM135 antibody (70R-6274) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM135 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM135 protein is part of a conserved genetic network involved in fat storage and longevity regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM135 antibody (70R-6274) | TMEM135 antibody (70R-6274) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors