TMEM138 antibody (70R-6431)

Rabbit polyclonal TMEM138 antibody raised against the N terminal of TMEM138

Synonyms Polyclonal TMEM138 antibody, Anti-TMEM138 antibody, TMEM 138, Transmembrane Protein 138 antibody, HSPC196 antibody, TMEM-138 antibody, TMEM 138 antibody, TMEM-138, TMEM138
Specificity TMEM138 antibody was raised against the N terminal of TMEM138
Cross Reactivity Human
Applications WB
Immunogen TMEM138 antibody was raised using the N terminal of TMEM138 corresponding to a region with amino acids MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVL
Assay Information TMEM138 Blocking Peptide, catalog no. 33R-6207, is also available for use as a blocking control in assays to test for specificity of this TMEM138 antibody

Images

Western Blot analysis using TMEM138 antibody (70R-6431)

TMEM138 antibody (70R-6431) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM138 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM138 is a multi-pass membrane protein.It belongs to the TMEM138 family. The function of the TMEM138 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM138 antibody (70R-6431) | TMEM138 antibody (70R-6431) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors