TMEM146 antibody (70R-7055)

Rabbit polyclonal TMEM146 antibody raised against the middle region of TMEM146

Synonyms Polyclonal TMEM146 antibody, Anti-TMEM146 antibody, TMEM 146, TMEM 146 antibody, TMEM146, MGC39581 antibody, TMEM-146, Transmembrane Protein 146 antibody, TMEM-146 antibody
Specificity TMEM146 antibody was raised against the middle region of TMEM146
Cross Reactivity Human
Applications WB
Immunogen TMEM146 antibody was raised using the middle region of TMEM146 corresponding to a region with amino acids NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA
Assay Information TMEM146 Blocking Peptide, catalog no. 33R-6818, is also available for use as a blocking control in assays to test for specificity of this TMEM146 antibody

Images

Western Blot analysis using TMEM146 antibody (70R-7055)

TMEM146 antibody (70R-7055) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM146 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM146 antibody (70R-7055) | TMEM146 antibody (70R-7055) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors