TMEM161A antibody (70R-6879)

Rabbit polyclonal TMEM161A antibody raised against the middle region of TMEM161A

Synonyms Polyclonal TMEM161A antibody, Anti-TMEM161A antibody, TMEM 161 antibody, TMEM 161, TMEM161, TMEM-161, FLJ39645 antibody, AROS-29 antibody, TMEM-161 antibody, FLJ20422 antibody, Transmembrane Protein 161A antibody
Specificity TMEM161A antibody was raised against the middle region of TMEM161A
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen TMEM161A antibody was raised using the middle region of TMEM161A corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR
Assay Information TMEM161A Blocking Peptide, catalog no. 33R-5117, is also available for use as a blocking control in assays to test for specificity of this TMEM161A antibody

Images

Western Blot analysis using TMEM161A antibody (70R-6879)

TMEM161A antibody (70R-6879) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM161A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM161A may be involved in the development of dendritic cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM161A antibody (70R-6879) | TMEM161A antibody (70R-6879) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors