TMEM161B antibody (70R-7081)

Rabbit polyclonal TMEM161B antibody raised against the N terminal of TMEM161B

Synonyms Polyclonal TMEM161B antibody, Anti-TMEM161B antibody, TMEM-161, TMEM 161 antibody, Transmembrane Protein 161B antibody, FLB3342 antibody, TMEM-161 antibody, TMEM 161, TMEM161, MGC33214 antibody, PRO1313 antibody
Specificity TMEM161B antibody was raised against the N terminal of TMEM161B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM161B antibody was raised using the N terminal of TMEM161B corresponding to a region with amino acids ESKPLTIPKDIDLHLETKSVTEVDTLALHYFPEYQWLVDFTVAATVVYLV
Assay Information TMEM161B Blocking Peptide, catalog no. 33R-2733, is also available for use as a blocking control in assays to test for specificity of this TMEM161B antibody


Western Blot analysis using TMEM161B antibody (70R-7081)

TMEM161B antibody (70R-7081) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM161B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM161B has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM161B antibody (70R-7081) | TMEM161B antibody (70R-7081) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors