TMEM166 antibody (70R-6649)

Rabbit polyclonal TMEM166 antibody raised against the N terminal Of Tmem166

Synonyms Polyclonal TMEM166 antibody, Anti-TMEM166 antibody, TMEM-166 antibody, TMEM 166, TMEM-166, FLJ13391 antibody, TMEM166, TMEM 166 antibody, Transmembrane Protein 166 antibody
Specificity TMEM166 antibody was raised against the N terminal Of Tmem166
Cross Reactivity Human
Applications WB
Immunogen TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA
Assay Information TMEM166 Blocking Peptide, catalog no. 33R-8044, is also available for use as a blocking control in assays to test for specificity of this TMEM166 antibody

Images

Western Blot analysis using TMEM166 antibody (70R-6649)

TMEM166 antibody (70R-6649) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM166 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM166 belongs to the FAM176 family. It acts as a regulator of programmed cell death, mediating both autophagy and apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM166 antibody (70R-6649) | TMEM166 antibody (70R-6649) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors