TMEM168 antibody (70R-6246)

Rabbit polyclonal TMEM168 antibody raised against the C terminal of TMEM168

Synonyms Polyclonal TMEM168 antibody, Anti-TMEM168 antibody, FLJ13576 antibody, TMEM-168, TMEM-168 antibody, DKFZp564C012 antibody, TMEM168, Transmembrane Protein 168 antibody, TMEM 168, TMEM 168 antibody
Specificity TMEM168 antibody was raised against the C terminal of TMEM168
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM168 antibody was raised using the C terminal of TMEM168 corresponding to a region with amino acids EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL
Assay Information TMEM168 Blocking Peptide, catalog no. 33R-2336, is also available for use as a blocking control in assays to test for specificity of this TMEM168 antibody

Images

Western Blot analysis using TMEM168 antibody (70R-6246)

TMEM168 antibody (70R-6246) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM168 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM168 antibody (70R-6246) | TMEM168 antibody (70R-6246) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors