TMEM16A antibody (70R-7004)

Rabbit polyclonal TMEM16A antibody raised against the middle region of TMEM16A

Synonyms Polyclonal TMEM16A antibody, Anti-TMEM16A antibody, ORAOV2 antibody, Transmembrane Protein 16A antibody, TAOS2 antibody, TMEMA 16 antibody, FLJ10261 antibody, TMEMA 16, TMEMA-16 antibody, TMEM16A, TMEMA-16
Specificity TMEM16A antibody was raised against the middle region of TMEM16A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM16A antibody was raised using the middle region of TMEM16A corresponding to a region with amino acids HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY
Assay Information TMEM16A Blocking Peptide, catalog no. 33R-3735, is also available for use as a blocking control in assays to test for specificity of this TMEM16A antibody

Images

Western Blot analysis using TMEM16A antibody (70R-7004)

TMEM16A antibody (70R-7004) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 111 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM16A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM16A (or ANO1)belongs to the anoctamin family. TMEM16A acts as a calcium-activated chloride channel. It is required for normal tracheal development. It has 8 transmembrane domains and its pore is large and non-selective, allowing other negatively charged species to permeate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM16A antibody (70R-7004) | TMEM16A antibody (70R-7004) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors