TMEM16C antibody (70R-6549)

Rabbit polyclonal TMEM16C antibody raised against the C terminal of TMEM16C

Synonyms Polyclonal TMEM16C antibody, Anti-TMEM16C antibody, GENX-3947 antibody, C11orf25 antibody, TMEMC-16, TMEMC 16 antibody, TMEMC 16, Transmembrane Protein 16C antibody, TMEM16C, TMEMC-16 antibody
Specificity TMEM16C antibody was raised against the C terminal of TMEM16C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM16C antibody was raised using the C terminal of TMEM16C corresponding to a region with amino acids AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL
Assay Information TMEM16C Blocking Peptide, catalog no. 33R-1181, is also available for use as a blocking control in assays to test for specificity of this TMEM16C antibody


Western Blot analysis using TMEM16C antibody (70R-6549)

TMEM16C antibody (70R-6549) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 115 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM16C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM16C antibody (70R-6549) | TMEM16C antibody (70R-6549) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors