TMEM16K antibody (70R-6573)

Rabbit polyclonal TMEM16K antibody raised against the C terminal of TMEM16K

Synonyms Polyclonal TMEM16K antibody, Anti-TMEM16K antibody, TMEMK 16, Transmembrane Protein 16K antibody, TMEMK-16, MGC47890 antibody, TMEM16K, FLJ10375 antibody, TMEMK 16 antibody, TMEMK-16 antibody
Specificity TMEM16K antibody was raised against the C terminal of TMEM16K
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM16K antibody was raised using the C terminal of TMEM16K corresponding to a region with amino acids LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA
Assay Information TMEM16K Blocking Peptide, catalog no. 33R-5070, is also available for use as a blocking control in assays to test for specificity of this TMEM16K antibody

Images

Western Blot analysis using TMEM16K antibody (70R-6573)

TMEM16K antibody (70R-6573) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM16K antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM16K is a multi-pass membrane protein. It belongs to the anoctamin family. TMEM16K may act as a calcium-activated chloride channel.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM16K antibody (70R-6573) | TMEM16K antibody (70R-6573) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors