TMEM184A antibody (70R-3358)

Rabbit polyclonal TMEM184A antibody raised against the C terminal of TMEM184A

Synonyms Polyclonal TMEM184A antibody, Anti-TMEM184A antibody, TMEMA 184 antibody, TMEM184A, MGC9712 antibody, TMEMA-184 antibody, FLJ24011 antibody, Transmembrane Protein 184A antibody, TMEMA 184, TMEMA-184
Specificity TMEM184A antibody was raised against the C terminal of TMEM184A
Cross Reactivity Human
Applications WB
Immunogen TMEM184A antibody was raised using the C terminal of TMEM184A corresponding to a region with amino acids CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT
Assay Information TMEM184A Blocking Peptide, catalog no. 33R-1788, is also available for use as a blocking control in assays to test for specificity of this TMEM184A antibody


Western Blot analysis using TMEM184A antibody (70R-3358)

TMEM184A antibody (70R-3358) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM184A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM184A antibody (70R-3358) | TMEM184A antibody (70R-3358) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors