Tmem184b Blocking Peptide (33R-10410)

A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem184b antibody, catalog no. 70R-8663

Synonyms Tmem184b control peptide, Tmem184b antibody Blocking Peptide, Anti-Tmem184b Blocking Peptide, transmembrane protein 184B Blocking Peptide, RGD1306591 Blocking Peptide, Tmem184b, Tmemb-184, Tmemb 184, Tmemb-184 Blocking Peptide, Tmemb 184 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues STVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATREL
Molecular Weight 44 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tmem184b may activate the MAP kinase signaling pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors