TMEM187 antibody (70R-7383)

Rabbit polyclonal TMEM187 antibody raised against the middle region of TMEM187

Synonyms Polyclonal TMEM187 antibody, Anti-TMEM187 antibody, TMEM 187, TMEM 187 antibody, TMEM-187 antibody, ITBA1 antibody, CXorf12 antibody, Transmembrane Protein 187 antibody, DXS9878E antibody, TMEM187, TMEM-187
Specificity TMEM187 antibody was raised against the middle region of TMEM187
Cross Reactivity Human
Applications WB
Immunogen TMEM187 antibody was raised using the middle region of TMEM187 corresponding to a region with amino acids ECVSLASYGLALLHPQGFEVALGAHVVAAVGQALRTHRHYGSTTSATYLA
Assay Information TMEM187 Blocking Peptide, catalog no. 33R-2300, is also available for use as a blocking control in assays to test for specificity of this TMEM187 antibody

Images

Western Blot analysis using TMEM187 antibody (70R-7383)

TMEM187 antibody (70R-7383) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM187 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM187 is a multi-pass membrane protein. The exact function of TMEM187 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM187 antibody (70R-7383) | TMEM187 antibody (70R-7383) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors