TMEM195 antibody (70R-6433)

Rabbit polyclonal TMEM195 antibody raised against the middle region of TMEM195

Synonyms Polyclonal TMEM195 antibody, Anti-TMEM195 antibody, FLJ16237 antibody, TMEM-195, Transmembrane Protein 195 antibody, TMEM195, TMEM 195 antibody, TMEM-195 antibody, TMEM 195, MGC131748 antibody
Specificity TMEM195 antibody was raised against the middle region of TMEM195
Cross Reactivity Human
Applications WB
Immunogen TMEM195 antibody was raised using the middle region of TMEM195 corresponding to a region with amino acids AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF
Assay Information TMEM195 Blocking Peptide, catalog no. 33R-1200, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody

Images

Western Blot analysis using TMEM195 antibody (70R-6433)

TMEM195 antibody (70R-6433) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM195 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM195 antibody (70R-6433) | TMEM195 antibody (70R-6433) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors