TMEM195 antibody (70R-6814)

Rabbit polyclonal TMEM195 antibody raised against the N terminal of TMEM195

Synonyms Polyclonal TMEM195 antibody, Anti-TMEM195 antibody, TMEM-195 antibody, MGC131748 antibody, Transmembrane Protein 195 antibody, TMEM-195, FLJ16237 antibody, TMEM195, TMEM 195 antibody, TMEM 195
Specificity TMEM195 antibody was raised against the N terminal of TMEM195
Cross Reactivity Human
Applications WB
Immunogen TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP
Assay Information TMEM195 Blocking Peptide, catalog no. 33R-9719, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody


Western Blot analysis using TMEM195 antibody (70R-6814)

TMEM195 antibody (70R-6814) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM195 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM195 belongs to the TMEM195 family. It is a multi-pass membrane protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM195 antibody (70R-6814) | TMEM195 antibody (70R-6814) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors