TMEM30A antibody (70R-6371)

Rabbit polyclonal TMEM30A antibody raised against the N terminal of TMEM30A

Synonyms Polyclonal TMEM30A antibody, Anti-TMEM30A antibody, FLJ10856 antibody, TMEMA 30 antibody, Transmembrane Protein 30A antibody, TMEMA-30 antibody, TMEM30A, TMEMA 30, TMEMA-30, CDC50A antibody, C6orf67 antibody
Specificity TMEM30A antibody was raised against the N terminal of TMEM30A
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications IHC, WB
Immunogen TMEM30A antibody was raised using the N terminal of TMEM30A corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC
Assay Information TMEM30A Blocking Peptide, catalog no. 33R-3094, is also available for use as a blocking control in assays to test for specificity of this TMEM30A antibody

Images

Immunohistochemical staining using TMEM30A antibody (70R-6371)

TMEM30A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM30A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM30A protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using TMEM30A antibody (70R-6371) | TMEM30A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using TMEM30A antibody (70R-6371) | TMEM30A antibody (70R-6371) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using TMEM30A antibody (70R-6371) | TMEM30A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors