TMEM30B antibody (70R-6444)

Rabbit polyclonal TMEM30B antibody raised against the middle region of TMEM30B

Synonyms Polyclonal TMEM30B antibody, Anti-TMEM30B antibody, MGC126775 antibody, Transmembrane Protein 30B antibody, CDC50B antibody, TMEMB-30 antibody, TMEM30B, TMEMB-30, TMEMB 30, TMEMB 30 antibody
Specificity TMEM30B antibody was raised against the middle region of TMEM30B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM30B antibody was raised using the middle region of TMEM30B corresponding to a region with amino acids VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL
Assay Information TMEM30B Blocking Peptide, catalog no. 33R-9922, is also available for use as a blocking control in assays to test for specificity of this TMEM30B antibody

Images

Western Blot analysis using TMEM30B antibody (70R-6444)

TMEM30B antibody (70R-6444) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM30B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM30B belongs to the CDC50/LEM3 family. It is a multi-pass membrane protein. The function of the TMEM30B protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM30B antibody (70R-6444) | TMEM30B antibody (70R-6444) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors