TMEM35 antibody (70R-7193)

Rabbit polyclonal TMEM35 antibody raised against the C terminal of TMEM35

Synonyms Polyclonal TMEM35 antibody, Anti-TMEM35 antibody, TMEM35, TMEM 35, Transmembrane Protein 35 antibody, FLJ14084 antibody, TMEM 35 antibody, TMEM-35, TMEM-35 antibody
Specificity TMEM35 antibody was raised against the C terminal of TMEM35
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS
Assay Information TMEM35 Blocking Peptide, catalog no. 33R-9525, is also available for use as a blocking control in assays to test for specificity of this TMEM35 antibody

Images

Western Blot analysis using TMEM35 antibody (70R-7193)

TMEM35 antibody (70R-7193) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM35 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM35 antibody (70R-7193) | TMEM35 antibody (70R-7193) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors