TMEM38A antibody (70R-6906)

Rabbit polyclonal TMEM38A antibody raised against the N terminal of TMEM38A

Synonyms Polyclonal TMEM38A antibody, Anti-TMEM38A antibody, TMEMA-38, Transmembrane Protein 38A antibody, TMEMA 38, TMEMA-38 antibody, TMEMA 38 antibody, TMEM38A, MGC3169 antibody
Specificity TMEM38A antibody was raised against the N terminal of TMEM38A
Cross Reactivity Human
Applications WB
Immunogen TMEM38A antibody was raised using the N terminal of TMEM38A corresponding to a region with amino acids GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE
Assay Information TMEM38A Blocking Peptide, catalog no. 33R-3241, is also available for use as a blocking control in assays to test for specificity of this TMEM38A antibody

Images

Western Blot analysis using TMEM38A antibody (70R-6906)

TMEM38A antibody (70R-6906) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM38A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM38A is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM38A antibody (70R-6906) | TMEM38A antibody (70R-6906) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors