TMEM38B antibody (70R-6887)

Rabbit polyclonal TMEM38B antibody raised against the C terminal of TMEM38B

Synonyms Polyclonal TMEM38B antibody, Anti-TMEM38B antibody, bA219P18.1 antibody, TMEMB 38, D4Ertd89e antibody, C9orf87 antibody, FLJ10493 antibody, TMEMB-38, Transmembrane Protein 38B antibody, TMEMB-38 antibody, TMEMB 38 antibody, TMEM38B
Specificity TMEM38B antibody was raised against the C terminal of TMEM38B
Cross Reactivity Human
Applications WB
Immunogen TMEM38B antibody was raised using the C terminal of TMEM38B corresponding to a region with amino acids WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE
Assay Information TMEM38B Blocking Peptide, catalog no. 33R-9980, is also available for use as a blocking control in assays to test for specificity of this TMEM38B antibody

Images

Western Blot analysis using TMEM38B antibody (70R-6887)

TMEM38B antibody (70R-6887) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM38B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM38B is a monovalent cation channel required for maintenance of rapid intracellular calcium release. It may act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM38B antibody (70R-6887) | TMEM38B antibody (70R-6887) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors