TMEM48 antibody (70R-7215)

Rabbit polyclonal TMEM48 antibody raised against the middle region of TMEM48

Synonyms Polyclonal TMEM48 antibody, Anti-TMEM48 antibody, TMEM-48, RP4-654H19.1 antibody, TMEM 48, Transmembrane Protein 48 antibody, FLJ34120 antibody, TMEM48, FLJ10407 antibody, NDC1 antibody, TMEM-48 antibody, FLJ12556 antibody, TMEM 48 antibody
Specificity TMEM48 antibody was raised against the middle region of TMEM48
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM48 antibody was raised using the middle region of TMEM48 corresponding to a region with amino acids PPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLL
Assay Information TMEM48 Blocking Peptide, catalog no. 33R-7260, is also available for use as a blocking control in assays to test for specificity of this TMEM48 antibody

Images

Western Blot analysis using TMEM48 antibody (70R-7215)

TMEM48 antibody (70R-7215) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM48 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM48 is a component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. TMEM48 is required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM48 antibody (70R-7215) | TMEM48 antibody (70R-7215) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors