TMEM63A antibody (70R-7098)

Rabbit polyclonal TMEM63A antibody raised against the N terminal of TMEM63A

Synonyms Polyclonal TMEM63A antibody, Anti-TMEM63A antibody, TMEMA-63 antibody, RP4-559A3.1 antibody, TMEMA 63 antibody, TMEM63A, KIAA0792 antibody, TMEMA-63, Transmembrane Protein 63A antibody, TMEMA 63, KIAA0489 antibody
Specificity TMEM63A antibody was raised against the N terminal of TMEM63A
Cross Reactivity Human
Applications WB
Immunogen TMEM63A antibody was raised using the N terminal of TMEM63A corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP
Assay Information TMEM63A Blocking Peptide, catalog no. 33R-5872, is also available for use as a blocking control in assays to test for specificity of this TMEM63A antibody

Images

Western Blot analysis using TMEM63A antibody (70R-7098)

TMEM63A antibody (70R-7098) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM63A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM63A antibody (70R-7098) | TMEM63A antibody (70R-7098) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors