TMEM63C antibody (70R-6894)

Rabbit polyclonal TMEM63C antibody raised against the middle region of TMEM63C

Synonyms Polyclonal TMEM63C antibody, Anti-TMEM63C antibody, TMEMC-63 antibody, TMEMC 63, TMEMC 63 antibody, TMEMC-63, Transmembrane Protein 63C antibody, C14orf171 antibody, TMEM63C
Specificity TMEM63C antibody was raised against the middle region of TMEM63C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM63C antibody was raised using the middle region of TMEM63C corresponding to a region with amino acids EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTM
Assay Information TMEM63C Blocking Peptide, catalog no. 33R-2348, is also available for use as a blocking control in assays to test for specificity of this TMEM63C antibody

Images

Western Blot analysis using TMEM63C antibody (70R-6894)

TMEM63C antibody (70R-6894) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM63C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM63C protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM63C antibody (70R-6894) | TMEM63C antibody (70R-6894) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors