TMEM66 antibody (70R-7326)

Rabbit polyclonal TMEM66 antibody raised against the middle region of TMEM66

Synonyms Polyclonal TMEM66 antibody, Anti-TMEM66 antibody, HSPC035 antibody, FOAP-7 antibody, XTP3 antibody, TMEM-66 antibody, TMEM 66, TMEM 66 antibody, TMEM-66, MGC8721 antibody, FLJ22274 antibody, Transmembrane Protein 66 antibody, TMEM66
Specificity TMEM66 antibody was raised against the middle region of TMEM66
Cross Reactivity Human
Applications WB
Immunogen TMEM66 antibody was raised using the middle region of TMEM66 corresponding to a region with amino acids TNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGL
Assay Information TMEM66 Blocking Peptide, catalog no. 33R-9213, is also available for use as a blocking control in assays to test for specificity of this TMEM66 antibody

Images

Western Blot analysis using TMEM66 antibody (70R-7326)

TMEM66 antibody (70R-7326) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM66 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM66 is a multi-pass membrane protein. It belongs to the TMEM66 family. The exact function of TMEM66 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM66 antibody (70R-7326) | TMEM66 antibody (70R-7326) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors