TMEM69 antibody (70R-6878)

Rabbit polyclonal TMEM69 antibody raised against the middle region of TMEM69

Synonyms Polyclonal TMEM69 antibody, Anti-TMEM69 antibody, TMEM69, TMEM 69, TMEM-69 antibody, TMEM 69 antibody, C1orf154 antibody, FLJ21029 antibody, Transmembrane Protein 69 antibody, MGC104183 antibody, RP11-767N6.4 antibody, TMEM-69
Specificity TMEM69 antibody was raised against the middle region of TMEM69
Cross Reactivity Human
Applications IHC, WB
Immunogen TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE
Assay Information TMEM69 Blocking Peptide, catalog no. 33R-1628, is also available for use as a blocking control in assays to test for specificity of this TMEM69 antibody

Images

Immunohistochemical staining using TMEM69 antibody (70R-6878)

TMEM69 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM69 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM69 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using TMEM69 antibody (70R-6878) | TMEM69 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using TMEM69 antibody (70R-6878) | TMEM69 antibody (70R-6878) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using TMEM69 antibody (70R-6878) | TMEM69 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors