TMEM74 antibody (70R-7022)

Rabbit polyclonal TMEM74 antibody raised against the middle region of TMEM74

Synonyms Polyclonal TMEM74 antibody, Anti-TMEM74 antibody, FLJ30668 antibody, TMEM-74 antibody, TMEM 74, Transmembrane Protein 74 antibody, TMEM 74 antibody, TMEM-74, TMEM74
Specificity TMEM74 antibody was raised against the middle region of TMEM74
Cross Reactivity Human
Applications WB
Immunogen TMEM74 antibody was raised using the middle region of TMEM74 corresponding to a region with amino acids ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR
Assay Information TMEM74 Blocking Peptide, catalog no. 33R-2701, is also available for use as a blocking control in assays to test for specificity of this TMEM74 antibody

Images

Western Blot analysis using TMEM74 antibody (70R-7022)

TMEM74 antibody (70R-7022) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM74 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM74 plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM74 antibody (70R-7022) | TMEM74 antibody (70R-7022) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors