TMEM79 antibody (70R-6744)

Rabbit polyclonal TMEM79 antibody raised against the C terminal of TMEM79

Synonyms Polyclonal TMEM79 antibody, Anti-TMEM79 antibody, FLJ32254 antibody, TMEM79, TMEM 79 antibody, TMEM 79, Transmembrane Protein 79 antibody, TMEM-79, MGC13102 antibody, TMEM-79 antibody, FLJ16057 antibody
Specificity TMEM79 antibody was raised against the C terminal of TMEM79
Cross Reactivity Human
Applications WB
Immunogen TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG
Assay Information TMEM79 Blocking Peptide, catalog no. 33R-5272, is also available for use as a blocking control in assays to test for specificity of this TMEM79 antibody

Images

Western Blot analysis using TMEM79 antibody (70R-6744)

TMEM79 antibody (70R-6744) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM79 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM79 is a multi-pass membrane protein. The exact function of TMEM79 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM79 antibody (70R-6744) | TMEM79 antibody (70R-6744) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors