TMEM9 antibody (70R-7412)

Rabbit polyclonal TMEM9 antibody raised against the C terminal of TMEM9

Synonyms Polyclonal TMEM9 antibody, Anti-TMEM9 antibody, TMEM-9, TMEM 9, TMEM-9 antibody, TMEM9, Transmembrane Protein 9 antibody, TMEM9A antibody, TMEM 9 antibody
Specificity TMEM9 antibody was raised against the C terminal of TMEM9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM9 antibody was raised using the C terminal of TMEM9 corresponding to a region with amino acids DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS
Assay Information TMEM9 Blocking Peptide, catalog no. 33R-1863, is also available for use as a blocking control in assays to test for specificity of this TMEM9 antibody


Western Blot analysis using TMEM9 antibody (70R-7412)

TMEM9 antibody (70R-7412) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM9 belongs to the TMEM9 family. It may be involved in intracellular transport.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM9 antibody (70R-7412) | TMEM9 antibody (70R-7412) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors