TMEM91 antibody (70R-6585)

Rabbit polyclonal TMEM91 antibody raised against the N terminal of TMEM91

Synonyms Polyclonal TMEM91 antibody, Anti-TMEM91 antibody, FLJ27310 antibody, TMEM-91 antibody, TMEM 91, TMEM 91 antibody, TMEM91, TMEM-91, Transmembrane Protein 91 antibody, FLJ45695 antibody
Specificity TMEM91 antibody was raised against the N terminal of TMEM91
Cross Reactivity Human
Applications WB
Immunogen TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL
Assay Information TMEM91 Blocking Peptide, catalog no. 33R-5873, is also available for use as a blocking control in assays to test for specificity of this TMEM91 antibody


Western Blot analysis using TMEM91 antibody (70R-6585)

TMEM91 antibody (70R-6585) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM91 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of TMEM91 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMEM91 antibody (70R-6585) | TMEM91 antibody (70R-6585) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors