TMEM93 antibody (70R-6642)

Rabbit polyclonal TMEM93 antibody raised against the N terminal of TMEM93

Synonyms Polyclonal TMEM93 antibody, Anti-TMEM93 antibody, TMEM 93 antibody, TMEM93, TMEM 93, MGC2963 antibody, TMEM-93 antibody, TMEM-93, Transmembrane Protein 93 antibody
Specificity TMEM93 antibody was raised against the N terminal of TMEM93
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMEM93 antibody was raised using the N terminal of TMEM93 corresponding to a region with amino acids AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG
Assay Information TMEM93 Blocking Peptide, catalog no. 33R-1062, is also available for use as a blocking control in assays to test for specificity of this TMEM93 antibody

Images

Western Blot analysis using TMEM93 antibody (70R-6642)

TMEM93 antibody (70R-6642) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM93 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMEM93 belongs to the TMEM93 family. It is a multi-pass membrane protein. The function of the TMEM93 protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMEM93 antibody (70R-6642) | TMEM93 antibody (70R-6642) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors