TMPRSS12 antibody (70R-7490)

Rabbit polyclonal TMPRSS12 antibody raised against the middle region of TMPRSS12

Synonyms Polyclonal TMPRSS12 antibody, Anti-TMPRSS12 antibody, TMPRSS-12, MGC57341 antibody, TMPRSS 12 antibody, Transmembrane Protease Serine 12 antibody, TMPRSS 12, TMPRSS-12 antibody, TMPRSS12
Specificity TMPRSS12 antibody was raised against the middle region of TMPRSS12
Cross Reactivity Human
Applications WB
Immunogen TMPRSS12 antibody was raised using the middle region of TMPRSS12 corresponding to a region with amino acids KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC
Assay Information TMPRSS12 Blocking Peptide, catalog no. 33R-4324, is also available for use as a blocking control in assays to test for specificity of this TMPRSS12 antibody

Images

Western Blot analysis using TMPRSS12 antibody (70R-7490)

TMPRSS12 antibody (70R-7490) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPRSS12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMPRSS12 belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMPRSS12 antibody (70R-7490) | TMPRSS12 antibody (70R-7490) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors