TMPRSS3 antibody (70R-3258)

Rabbit polyclonal TMPRSS3 antibody raised against the N terminal of TMPRSS3

Synonyms Polyclonal TMPRSS3 antibody, Anti-TMPRSS3 antibody, ECHOS1 antibody, DFNB8 antibody, DFNB10 antibody, TMPRSS 3 antibody, TADG12 antibody, TMPRSS 3, TMPRSS-3, TMPRSS-3 antibody, Transmembrane Protease Serine 3 antibody, TMPRSS3
Specificity TMPRSS3 antibody was raised against the N terminal of TMPRSS3
Cross Reactivity Human
Applications WB
Immunogen TMPRSS3 antibody was raised using the N terminal of TMPRSS3 corresponding to a region with amino acids MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP
Assay Information TMPRSS3 Blocking Peptide, catalog no. 33R-6021, is also available for use as a blocking control in assays to test for specificity of this TMPRSS3 antibody


Western Blot analysis using TMPRSS3 antibody (70R-3258)

TMPRSS3 antibody (70R-3258) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPRSS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a serine protease domain, a transmembrane domain, a LDL receptor-like domain, and a scavenger receptor cysteine-rich domain. Serine proteases are known to be involved in a variety of biological processes, whose malfunction often leads to human diseases and disorders.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TMPRSS3 antibody (70R-3258) | TMPRSS3 antibody (70R-3258) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors