TMPRSS6 antibody (70R-4605)

Rabbit polyclonal TMPRSS6 antibody raised against the N terminal of TMPRSS6

Synonyms Polyclonal TMPRSS6 antibody, Anti-TMPRSS6 antibody, TMPRSS6, TMPRSS 6 antibody, TMPRSS 6, TMPRSS-6, Transmembrane Protease Serine 6 antibody, TMPRSS-6 antibody
Specificity TMPRSS6 antibody was raised against the N terminal of TMPRSS6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TMPRSS6 antibody was raised using the N terminal of TMPRSS6 corresponding to a region with amino acids LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK
Assay Information TMPRSS6 Blocking Peptide, catalog no. 33R-5200, is also available for use as a blocking control in assays to test for specificity of this TMPRSS6 antibody


Western blot analysis using TMPRSS6 antibody (70R-4605)

Recommended TMPRSS6 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMPRSS6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using TMPRSS6 antibody (70R-4605) | Recommended TMPRSS6 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using TMPRSS6 antibody (70R-4605) | Liver

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors