TMTC1 antibody (70R-7426)

Rabbit polyclonal TMTC1 antibody raised against the middle region of TMTC1

Synonyms Polyclonal TMTC1 antibody, Anti-TMTC1 antibody, TMTC 1, ARG99 antibody, TMTC1, FLJ41625 antibody, FLJ31400 antibody, TMTC-1, TMTC-1 antibody, OLF antibody, TMTC 1 antibody, Transmembrane And Tetratricopeptide Repeat Containing 1 antibody
Specificity TMTC1 antibody was raised against the middle region of TMTC1
Cross Reactivity Human
Applications WB
Immunogen TMTC1 antibody was raised using the middle region of TMTC1 corresponding to a region with amino acids GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV
Assay Information TMTC1 Blocking Peptide, catalog no. 33R-3468, is also available for use as a blocking control in assays to test for specificity of this TMTC1 antibody

Images

Western Blot analysis using TMTC1 antibody (70R-7426)

TMTC1 antibody (70R-7426) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMTC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TMTC1 antibody (70R-7426) | TMTC1 antibody (70R-7426) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors