TNFSF13B antibody (70R-5968)

Rabbit polyclonal TNFSF13B antibody

Synonyms Polyclonal TNFSF13B antibody, Anti-TNFSF13B antibody, TALL-1 antibody, CD257 antibody, delta BAFF antibody, ZTNF4 antibody, TNFSF 13, TNFSF13, Tumor Necrosis Factor Superfamily 13b antibody, THANK antibody, TNFSF 13 antibody, TNFSF20 antibody, TNFSF-13, BAFF antibody, TALL1 antibody, BLYS antibody, TNFSF-13 antibody
Cross Reactivity Human
Applications WB
Immunogen TNFSF13B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
Assay Information TNFSF13B Blocking Peptide, catalog no. 33R-1363, is also available for use as a blocking control in assays to test for specificity of this TNFSF13B antibody

Images

Western Blot analysis using TNFSF13B antibody (70R-5968)

TNFSF13B antibody (70R-5968) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNFSF13B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TNFSF13B antibody (70R-5968) | TNFSF13B antibody (70R-5968) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors