TNIP1 Blocking Peptide (33R-10405)

A synthetic peptide for use as a blocking control in assays to test for specificity of TNIP1 antibody, catalog no. 70R-10358

Synonyms TNIP1 control peptide, TNIP1 antibody Blocking Peptide, Anti-TNIP1 Blocking Peptide, TNFAIP3 interacting protein 1 Blocking Peptide, ABIN-1 Blocking Peptide, KIAA0113 Blocking Peptide, NAF1 Blocking Peptide, VAN Blocking Peptide, TNIP1, TNIP-1, TNIP 1, TNIP-1 Blocking Peptide, TNIP 1 Blocking Peptide
Protein Type Synthetic
Applications WB

Specifications

Residues SPTAPACPSDKPAPVQKPPSSGTSSEFEVVTPEEQNSPESSSHANAMALG
Molecular Weight 70 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNIP1 interacts with zinc finger protein A20/TNFAIP3 and inhibits TNF-induced NF-kappa-B-dependent gene expression by interfering with an RIP- or TRAF2-mediated transactivation signal. TNIP1 increases cell surface CD4(T4) antigen expression. TNIP1 interacts with HIV-1 matrix protein and is packaged into virions and overexpression can inhibit viral replication. TNIP1 may regulate matrix nuclear localization, both nuclear import of PIC (Preintegration complex) and export of GAG polyprotein and viral genomic RNA during virion production.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors