TNNI3K antibody (70R-4101)

Rabbit polyclonal TNNI3K antibody raised against the middle region of TNNI3K

Synonyms Polyclonal TNNI3K antibody, Anti-TNNI3K antibody, CARK antibody, TNNIK 3, Tnni3 Interacting Kinase antibody, TNNIK-3, MGC33828 antibody, TNNI3K, TNNIK-3 antibody, TNNIK 3 antibody, MGC142099 antibody
Specificity TNNI3K antibody was raised against the middle region of TNNI3K
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TNNI3K antibody was raised using the middle region of TNNI3K corresponding to a region with amino acids PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY
Assay Information TNNI3K Blocking Peptide, catalog no. 33R-7128, is also available for use as a blocking control in assays to test for specificity of this TNNI3K antibody

Images

Western Blot analysis using TNNI3K antibody (70R-4101)

TNNI3K antibody (70R-4101) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 93 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNNI3K antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNNI3K may play a role in cardiac physiology.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TNNI3K antibody (70R-4101) | TNNI3K antibody (70R-4101) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors