TNP1 antibody (70R-3172)

Rabbit polyclonal TNP1 antibody

Synonyms Polyclonal TNP1 antibody, Anti-TNP1 antibody, TNP-1, TNP-1 antibody, TNP 1 antibody, TNP1, TNP 1, Transition Protein 1 antibody, TP1 antibody
Cross Reactivity Human
Applications WB
Immunogen TNP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN
Assay Information TNP1 Blocking Peptide, catalog no. 33R-6520, is also available for use as a blocking control in assays to test for specificity of this TNP1 antibody


Western Blot analysis using TNP1 antibody (70R-3172)

TNP1 antibody (70R-3172) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 6 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TNP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TNP1 antibody (70R-3172) | TNP1 antibody (70R-3172) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors