TOLLIP antibody (70R-5778)

Rabbit polyclonal TOLLIP antibody raised against the C terminal of TOLLIP

Synonyms Polyclonal TOLLIP antibody, Anti-TOLLIP antibody, FLJ33531 antibody, IL-1RAcPIP antibody, Toll Interacting Protein antibody
Specificity TOLLIP antibody was raised against the C terminal of TOLLIP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen TOLLIP antibody was raised using the C terminal of TOLLIP corresponding to a region with amino acids MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG
Assay Information TOLLIP Blocking Peptide, catalog no. 33R-5792, is also available for use as a blocking control in assays to test for specificity of this TOLLIP antibody

Images

Western Blot analysis using TOLLIP antibody (70R-5778)

TOLLIP antibody (70R-5778) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TOLLIP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TOLLIP is component of the signaling pathway of IL-1 and Toll-like receptors. It Inhibits cell activation by microbial products. It also recruits IRAK1 to the IL-1 receptor complex and inhibits IRAK1 phosphorylation and kinase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using TOLLIP antibody (70R-5778) | TOLLIP antibody (70R-5778) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors