TOM1L2 antibody (70R-3299)

Rabbit polyclonal TOM1L2 antibody

Synonyms Polyclonal TOM1L2 antibody, Anti-TOM1L2 antibody, TOM-1, TOM-1 antibody, TOM 1 antibody, TOM1, Target Of Myb1-Like 2 antibody, TOM 1, FLJ32746 antibody
Cross Reactivity Human
Applications WB
Immunogen TOM1L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP
Assay Information TOM1L2 Blocking Peptide, catalog no. 33R-7685, is also available for use as a blocking control in assays to test for specificity of this TOM1L2 antibody


Western Blot analysis using TOM1L2 antibody (70R-3299)

TOM1L2 antibody (70R-3299) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TOM1L2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TOM1L2 may regulate growth factor-induced mitogenic signaling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using TOM1L2 antibody (70R-3299) | TOM1L2 antibody (70R-3299) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors